Core/Dash Pricing

CoreDash is built as a counterbalance to pricey Core Web Vitals monitoring tools. We offer high quality Core Web Vitals monitoring without the marketing overhead!  . 

lighthouse 100 score

Trusted by market leaders

harvardsaturnworkivanestlealeteiamarktplaatshappyhorizonnina carekpndpg mediafotocasasnvvpnloopearplugsmonarchadevintaperionerasmusmccompareebaywhowhatwear

CoreDash pricing

As a Core Web Vitals Consultant, I understand the importance of having accurate and real-time data to optimize website's performance. After working with various tools on the market, I was not happy with their complex pricing structures and hidden fees. 

That's why I created Core/Dash. Built on the same Google Web Vitals library used by industry-leading tools, CoreDash provides accurate, real-time data without the unnecessary costs.

I believe teams deserve performance tools without overpaying. Frustrated by competitors' steep pricing, we built a solution that’s fair, accessible, and focused on delivering value.

CoreDash is designed to help businesses improve Core Web Vitals and user experience without sacrificing budget. By prioritizing simplicity and affordability, it’s a practical choice for teams looking for real-time advanced insights without unnecessary costs.

Why pay enterprise prices for developer tools?

CoreDas is built by a developer, not a corporation. Priced for teams, not enterprises. When we compare pricing of the most populair RUM tracking tools out there there is only one clear winner. CoreDash outperforms Speetals, RUMVision, DebugBear and Speedcure on price and offers full features even on the starter packages!

Feature CoreDash Speetals SpeedCurveRUMVisionDebugBear
Price $18 $69 $83$ 95 $325
Core Web Vitals  Yes Yes Yes Yes Yes
Page View Limits 150K 250K 500K750K 500K
CrUX Tracking Yes No NoNo Yes
AlertingIncludedIncludedIncludedIncludedIncluded
AdvisorIncluded--------
Full featuresFull featuresOnly 30 pagesno,limitedno, limitedFull features

* Lowest monthly prices that include RUM Tracking


CoreDash pricing


Starter

$18 / mo
For small sites
  • 50K page-views / month
  • 60 days data retention*
  • track unlimited pages
  • 1 domain
  • CrUX tracking 

Standard

$35 / mo
Your best option
  • 150K page-views / month
  • 365 days data retention*
  • track unlimited pages
  • 2 domains
  • CrUX tracking 

Enterprise

$149 / mo
Enterprise level insights
  • 2M page-views / mo
  • 365 days data retention*
  • track unlimited pages
  • 3 domains
  • CrUX tracking 

Sentinel

$7 / mo
For sites that are allready fast and need to stay fast. Sentinel Mode tracks the Core Web Vitals in bursts saving resources and money.



Agency: for agency packages and custom solutions read this

CoreDash PricingCore Web Vitals CoreDash Pricing